PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G057400.1.p
Common NameGLYMA_08G057400, LOC100796808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 722aa    MW: 80097.8 Da    PI: 6.6457
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G057400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-202580156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         r++ +++t++q+++Le++F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Glyma.08G057400.1.p 25 RKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 80
                         789999***********************************************998 PP

2START171.74.8e-542264502206
                          HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          +a  a++e++++++ +ep+W ks     + +  d + + f + ++       ++ea+r+sgvv m++  lv  ++d + +W + ++    
  Glyma.08G057400.1.p 226 IASNAMEEFLRLVQTNEPLWLKSNvdarDVLSCDAYERMFHKPNTrpknpnVRIEASRDSGVVLMNTLALVDMFMDPN-KWIQLFPtivs 314
                          67899*******************9999555555555555444445678889**************************.99999999999 PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                           a t++vissg      g lqlm++elq+lsplv+ R+f+f+Ry++q ++g+w+++dvS d +q+    ++  R+++ pSg+li+++++g
  Glyma.08G057400.1.p 315 VARTIQVISSGmmgscsGSLQLMYQELQVLSPLVStREFYFLRYCQQIEQGTWAVMDVSYDFPQDSH-YAPQFRSHRCPSGCLIQDMPDG 403
                          *****************************************************************99.8********************* PP

                          EEEEEEEE-EE--SS.XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgr.lphwllrslvksglaegaktwvatlqrqcek 206
                          hsk+twvehv+ +++ lph l+r l+ sg+a+ga +w+ tlqr ce+
  Glyma.08G057400.1.p 404 HSKITWVEHVEIEDKtLPHRLYRNLIYSGMAFGAERWLTTLQRMCER 450
                          ************876267***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.96E-20782IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-231084IPR009057Homeodomain-like
PROSITE profilePS5007118.0912282IPR001356Homeobox domain
SMARTSM003891.2E-182386IPR001356Homeobox domain
CDDcd000867.37E-192483No hitNo description
PfamPF000469.5E-182580IPR001356Homeobox domain
PROSITE patternPS0002705780IPR017970Homeobox, conserved site
PROSITE profilePS5084851.042216453IPR002913START domain
SuperFamilySSF559613.56E-36217451No hitNo description
CDDcd088754.18E-112220449No hitNo description
SMARTSM002344.9E-44225450IPR002913START domain
PfamPF018522.6E-46226450IPR002913START domain
Gene3DG3DSA:3.30.530.207.8E-10279433IPR023393START-like domain
SuperFamilySSF559611.35E-23471711No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MEYGSGGGGS QSPGEQDGSD SQERRKRYHR HTANQIQRLE SMFKECPHPD EKQRLQLSRE  60
LGLAPRQIKF WFQNRRTQMK AQHERADNCA LRADNDKIRC ENIAIREALK NVICPSCGAP  120
PLNDDCYFDD QKLRLENAHL KEELDRVSSI AAKYIGRPIS QLPPVQPIHI SSLDLSMASY  180
GNQGMVGPAP SSLNLDLLPA AGTSSSSMPY HPPCLSDMDK SLMSDIASNA MEEFLRLVQT  240
NEPLWLKSNV DARDVLSCDA YERMFHKPNT RPKNPNVRIE ASRDSGVVLM NTLALVDMFM  300
DPNKWIQLFP TIVSVARTIQ VISSGMMGSC SGSLQLMYQE LQVLSPLVST REFYFLRYCQ  360
QIEQGTWAVM DVSYDFPQDS HYAPQFRSHR CPSGCLIQDM PDGHSKITWV EHVEIEDKTL  420
PHRLYRNLIY SGMAFGAERW LTTLQRMCER LTYLMATSNP TRDNLGGVIS SPEGKRSMMK  480
LAQRMVTNFC ANISTSSGHR WTTLSGLNEI VVRVTVHKSS DPGQPNGVVL SAATTIWLPT  540
PPHAVFNFFK DENKRPQWDV LSNGNAVQEV ANIANGLHPG NSISVLRAFN NSTQNMLILQ  600
ESCIDSYGSF VVYCPVDLPS INLAMSGEDP SYIPLLPNGF TILPDGQPDQ EGDDGASTSS  660
NNANRNIVRS GGSLVTIAFQ ILVSSLPSAK LNMESVTTVN NLIGSTVQQI KSSLSCPTLP  720
S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-105AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006584925.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
RefseqXP_006584924.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
RefseqXP_006584923.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
RefseqXP_006584922.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0B2NX990.0A0A0B2NX99_GLYSO; Homeobox-leucine zipper protein HDG11-like protein
TrEMBLI1KQN60.0I1KQN6_SOYBN; Uncharacterized protein
STRINGGLYMA08G06190.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11